05-23-2151 PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem

Price could not be retrieved
Minimum Quantity needs to be mulitiple of
Upon Order Completion More Information
You Saved ()
Request Pricing
Limited AvailabilityLimited Availability
Limited Quantities Available
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service
      View Pricing & Availability


      Replacement Information

      Key Specifications Table

      Empirical FormulaCAS #
      C₁₄₂H₂₂₄N₄₀O₃₉S 127317-03-7

      Pricing & Availability

      Catalog Number AvailabilityPackaging Qty/Pack Price Quantity
      Retrieving availability...
      Limited AvailabilityLimited Availability
      Limited Quantities Available
        Remaining : Will advise
          Remaining : Will advise
          Will advise
          Contact Customer Service
          Contact Customer Service

          Glass bottle .5 mg
          Retrieving price...
          Price could not be retrieved
          Minimum Quantity needs to be mulitiple of
          Upon Order Completion More Information
          You Saved ()
          Request Pricing
          OverviewIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
          Catalogue Number05-23-2151
          Brand Family Calbiochem®
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
          Product Information
          CAS number127317-03-7
          ATP CompetitiveN
          FormWhite to off-white solid
          FormulationSupplied as a trifluoroacetate salt.
          Hill FormulaC₁₄₂H₂₂₄N₄₀O₃₉S
          Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
          Hygroscopic Hygroscopic
          Sold on the basis of peptide contentY
          Quality LevelMQ100
          Biological Information
          Primary TargetIncreases cAMP levels
          Primary Target IC<sub>50</sub>EC50 = 4.7 nM increasing cAMP levels in a dose-dependent manner
          Purity≥98% by HPLC
          Physicochemical Information
          Cell permeableN
          Peptide ContentY
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Standard Handling
          Storage -20°C
          Hygroscopic Hygroscopic
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
          Packaging Information
          Transport Information
          Supplemental Information


          PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem SDS


          Safety Data Sheet (SDS) 

          PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem Certificates of Analysis

          TitleLot Number


          Reference overview
          Kobayashi, H., et al. 1994. Brain Res. 647, 145.
          Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
          Data Sheet

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision12-May-2008 JSW
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
          DescriptionIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
          FormWhite to off-white solid
          FormulationSupplied as a trifluoroacetate salt.
          CAS number127317-03-7
          Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
          Purity≥98% by HPLC
          Solubility5% Acetic acid (1 mg/ml)
          Storage -20°C
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
          Toxicity Standard Handling
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.