Information
X


05-23-2350  Galanin, Porcine

GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2

For general questions please contact our Customer Service:

EMD Millipore
290 Concord Road
01821 Billerica, MA
United States
Phone: 781 533-6000
Fax: +49 6151 72 2000
E-mail: Customer.CareDesk@emdchemicals.com

Contact us


25 May 2012

loading
 
Kindly contact Customer Service to order this product.
A biologically active neuropeptide that has been shown to inhibit secretion of somatostatin, insulin, and pancreatic polypeptide. Also induces repolarization and reduces free Ca2+ due to interference with voltage-activated Ca2+ channels. Inhibits ω-conotoxin GVIA-sensitive Ca2+ channels in parasympathetic neurons. Reported to have an inhibitory role in transmission of nociceptive information.
Product information
Peptide Sequence H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2
Form White to off-white lyophilized solid
Formulation Sold on the basis of peptide content.
Molar mass 3210.6
Protect from Moisture Yes
Purity ≥97% by HPLC
Sold on the basis of peptide content Yes
Solubility 5% Acetic Acid
Chemical formula C146H213N43O40
CAS number 88813-36-9
Store and ship information
Storage -20°C to 0°C
Ship Ambient Temperature Only
Standard Handling

© Merck KGaA, Darmstadt, Germany, 2012

All references to Merck refer to Merck KGaA, Darmstadt, Germany.


x

Welcome to EMD Millipore

 

Europe, Middle East and Africa Asia / Pacific North America, Central America and the Carribean South America

Please select your country:

North America, Central America and the Carribean

South America

Europe, Middle East and Africa

Asia / Pacific

All countries from A to Z

If you can't find your country please click here.

 

x

EMD Millipore Chemicals Cart ()

You are entering the Millipore online shop. Both carts are maintained for you while you shop between sites. We recommend to complete your Merck order before visiting Millipore.com.

Go to Millipore Proceed to checkout


What kind of products are you looking for?

Millipore

Bio manufacturing and Life science.

EMD Millipore Chemicals

High-quality industrial and laboratory chemicals.


Important message


It is currently not possible to order Bioscience products together with other EMD products. We recommend completing your current order first.

Do you wish to proceed without completing your current order? If so, this will empty your shopping cart.