171545
β-Amyloid Precursor Protein, CTF-50, Synthetic
C50, APP721-770, VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
For general questions please contact our Customer Service:
EMD Millipore
290 Concord Road
01821 Billerica, MA
United States
Phone: 781 533-6000
Fax: +49 6151 72 2000
E-mail: Customer.CareDesk@emdchemicals.com
25 May 2012
loading
Kindly contact Customer Service to order this product.
A 50-amino acid peptide resulting from the γ-secretase cleavage of the C-terminus of β-amyloid precursor protein (APP) at Leu720-Val721.
| Product information | |||
|---|---|---|---|
| Peptide Sequence | H-Val-Met-Leu-Lys-Lys-Lys-Gln-Tyr-Thr-Ser-Ile-His-His-Gly-Val-Val-Glu-Val-Asp-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH | ||
| Form | Lyophilized | ||
| Formulation | Supplied as a trifluoroacetate salt. | ||
| Molar mass | 5910.7 | ||
| Protect from Light | Yes | ||
| Hygrocopic | Yes | ||
| Packaged under inert gas | Yes | ||
| Purity | ≥95% by HPLC | ||
| Solubility | DMSO | ||
| Chemical formula | C261H404N72O79S3 | ||
| Store and ship information | |||
|---|---|---|---|
| Storage | -20°C | ||
| Ship |
Blue Ice Only
Standard Handling |
||
