171596
β-Amyloid Peptide (1-42), Rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
For general questions please contact our Customer Service:
EMD Millipore
290 Concord Road
01821 Billerica, MA
United States
Phone: 781 533-6000
Fax: +49 6151 72 2000
E-mail: Customer.CareDesk@emdchemicals.com
25 May 2012
loading
Predominant peptide found in the brain of patients with Alzheimer’s Disease and Down’s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
| Product information | |||
|---|---|---|---|
| Peptide Sequence | H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH | ||
| Form | Lyophilized | ||
| Formulation | Supplied as a trifluoroacetate salt. | ||
| Molar mass | 4418 | ||
| Hygrocopic | Yes | ||
| Purity | ≥80% by HPLC | ||
| Solubility | 5% Acetic Acid | ||
| Chemical formula | C199H307N53O59S | ||
| CAS number | 107761-42-2 | ||
| Store and ship information | |||
|---|---|---|---|
| Storage | -20°C | ||
| Ship |
Ambient Temperature Only
Standard Handling |
||
