Information
X


171596  β-Amyloid Peptide (1-42), Rat

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

For general questions please contact our Customer Service:

EMD Millipore
290 Concord Road
01821 Billerica, MA
United States
Phone: 781 533-6000
Fax: +49 6151 72 2000
E-mail: Customer.CareDesk@emdchemicals.com

Contact us


25 May 2012

loading
 
Product number Qty/Pk Quantity Price Delivery Date
      Please login to see your account specific pricing.
171596-250UG  250 μg 
loading
Bulk available     Please request a quote  
 
Prices are subject to change without notice.
Predominant peptide found in the brain of patients with Alzheimer’s Disease and Down’s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
Product information
Peptide Sequence H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Form Lyophilized
Formulation Supplied as a trifluoroacetate salt.
Molar mass 4418
Hygrocopic Yes
Purity ≥80% by HPLC
Solubility 5% Acetic Acid
Chemical formula C199H307N53O59S
CAS number 107761-42-2
Store and ship information
Storage -20°C
Ship Ambient Temperature Only
Standard Handling

© Merck KGaA, Darmstadt, Germany, 2012

All references to Merck refer to Merck KGaA, Darmstadt, Germany.


x

Welcome to EMD Millipore

 

Europe, Middle East and Africa Asia / Pacific North America, Central America and the Carribean South America

Please select your country:

North America, Central America and the Carribean

South America

Europe, Middle East and Africa

Asia / Pacific

All countries from A to Z

If you can't find your country please click here.

 

x

EMD Millipore Chemicals Cart ()

You are entering the Millipore online shop. Both carts are maintained for you while you shop between sites. We recommend to complete your Merck order before visiting Millipore.com.

Go to Millipore Proceed to checkout


What kind of products are you looking for?

Millipore

Bio manufacturing and Life science.

EMD Millipore Chemicals

High-quality industrial and laboratory chemicals.


Important message


It is currently not possible to order Bioscience products together with other EMD products. We recommend completing your current order first.

Do you wish to proceed without completing your current order? If so, this will empty your shopping cart.