PP68
β-Amyloid Peptide (1-40, Gln22), Human
DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
For general questions please contact our Customer Service:
EMD Millipore
290 Concord Road
01821 Billerica, MA
United States
Phone: 781 533-6000
Fax: +49 6151 72 2000
E-mail: Customer.CareDesk@emdchemicals.com
25 May 2012
loading
Kindly contact Customer Service to order this product.
Human Aβ1-40 peptide containing the Dutch mutation of Gln at position 22. This product is supplied in a form that is not neurotoxic prior to a pre-incubation step. The level of toxicity has been shown to correlate to the extent of beta sheet structure.
| Product information | |||
|---|---|---|---|
| Region | Synthetic peptide corresponding to amino acids 1 - 40 of the processed human β-amyloid peptide with a substitution of Gln22 | ||
| Peptide Sequence | H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH | ||
| Form | Lyophilized | ||
| Molar mass | 4330 | ||
| Applications |
|
||
| Hygrocopic | Yes | ||
| Biological activity | Neurotoxic activity typically observed in the range of 30-100 µg/ml | ||
| Purity | ≥97% by HPLC | ||
| Solubility | HPLC-grade H2O | ||
| Chemical formula | C194H297N55O56S | ||
| Store and ship information | |||
|---|---|---|---|
| Storage | -20°C | ||
| Ship |
Ambient Temperature Only
Standard Handling |
||
