A part of MilliporeSigma

613571 | TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem

613571
Price could not be retrieved
Minimum Quantity needs to be mulitiple of
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Limited AvailabilityLimited Availability
Stocked 
Discontinued
Limited Quantities Available
Available
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      View Pricing & Availability
      Click To Print This Page

      Overview

      Replacement Information

      Key Specifications Table

      Empirical Formula
      C₁₆₃H₂₆₈N₅₂O₃₈S

      Pricing & Availability

      Catalog NumberAvailability Packaging Qty/Pack Price Quantity
      613571-1MG
      Retrieving availability...
      Limited AvailabilityLimited Availability
      Stocked 
      Discontinued
      Limited Quantities Available
      Available
        Remaining : Will advise
          Remaining : Will advise
          Will advise
          Contact Customer Service

          Glass bottle 1 mg
          Retrieving price...
          Price could not be retrieved
          Minimum Quantity needs to be mulitiple of
          Upon Order Completion More Information
          You Saved ()
           
          Request Pricing
          Description
          OverviewA cell-permeable synthetic peptide containing mouse TIRAP151-138, reverse sequence, fused to the Drosophila Antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).
          Catalogue Number613571
          Brand Family Calbiochem®
          SynonymsAnt-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
          References
          ReferencesHorng, T., et al. 2001. Nat. Immunol. 2, 835.
          Product Information
          ATP CompetitiveN
          FormWhite lyophilized solid
          FormulationSupplied as a trifluoroacetate salt.
          Hill FormulaC₁₆₃H₂₆₈N₅₂O₃₈S
          Chemical formulaC₁₆₃H₂₆₈N₅₂O₃₈S
          Hygroscopic Hygroscopic
          ReversibleN
          Applications
          Biological Information
          Primary TargetControl for TIRAP inhibitor
          Purity≥97% by HPLC
          Physicochemical Information
          Cell permeableY
          Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH
          Dimensions
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Blue Ice Only
          Toxicity Standard Handling
          Storage -20°C
          Protect from Light Protect from light
          Hygroscopic Hygroscopic
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Packaging Information
          Packaged under inert gas Packaged under inert gas
          Transport Information
          Supplemental Information
          Specifications

          Documentation

          SDS

          Title

          Safety Data Sheet (SDS) 

          Certificates of Analysis

          TitleLot Number
          613571

          References

          Reference overview
          Horng, T., et al. 2001. Nat. Immunol. 2, 835.
          Data Sheet

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision12-September-2008 RFH
          SynonymsAnt-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
          DescriptionA cell-permeable synthetic peptide containing mouse toll-interleukin 1 receptor (TIR) domain-containing adapter protein 151-138 reverse sequence (TIRAP; also called Mal (MyD88-adapter-like), fused to the Drosophila antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).
          FormWhite lyophilized solid
          FormulationSupplied as a trifluoroacetate salt.
          Intert gas (Yes/No) Packaged under inert gas
          Chemical formulaC₁₆₃H₂₆₈N₅₂O₃₈S
          Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH
          Purity≥97% by HPLC
          SolubilityDMSO (5 mg/ml)
          Storage -20°C
          Protect from light
          Hygroscopic
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Toxicity Standard Handling
          ReferencesHorng, T., et al. 2001. Nat. Immunol. 2, 835.