532385 CaM Kinase II Inhibitor, TATCN21 and Negative Control Set - Calbiochem

532385
Price could not be retrieved
Minimum Quantity needs to be mulitiple of
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Limited AvailabilityLimited Availability
Stocked 
Discontinued
Limited Quantities Available
Available
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service
      View Pricing & Availability

      Overview

      Replacement Information

      Key Specifications Table

      Pricing & Availability

      Catalog Number AvailabilityPackaging Qty/Pack Price Quantity
      5.32385.0001
      Retrieving availability...
      Limited AvailabilityLimited Availability
      Stocked 
      Discontinued
      Limited Quantities Available
      Available
        Remaining : Will advise
          Remaining : Will advise
          Will advise
          Contact Customer Service
          Contact Customer Service

          Glass bottle 1 set
          Retrieving price...
          Price could not be retrieved
          Minimum Quantity needs to be mulitiple of
          Upon Order Completion More Information
          You Saved ()
           
          Request Pricing
          Description
          OverviewA cell permeable TAT sequence fused with a 21 amino acid peptide derived from the naturally occurring inhibitor protein CaM-KIIN (a.a.43-63; KRPPKLGQIGRSKRVVIEDDR). Acts as a selective, reversible, T-site targeting, inhibitor of CaM Kinase II (~5 µM). Effectively blocks CaM kinase II autophophorylation on Thr305/306, however, its effect on Thr286 phosphorylation is not significant. Inhibits both α and β isoforms of CaM kinase II and is shown to block autonomous and stimulated CaM kinase II activities with equal potency. Does not affect the activity of CaM kinase I, protein kinase A, and protein kinase C, however, at 5 µM it has a very mild effect on CaM Kinase IV. Blocks NMDA-induced translocation of CaM kinase II to post-synaptic densities and also inhibits binding of CaM kinase II to NR2B (~1 µM). Shown to reverse long-term potentiation and reduce basal synaptic strength (~ 20 µM). Its inhibitory effects are largely restricted to dendrites, with minimal effect in the soma. The control peptide included in this set contains the TAT sequence fused to a scrambled sequence (VKEPRIDGKPVRLRGQKSDRI).
          Catalogue Number532385
          Brand Family Calbiochem®
          Synonymstat-fused CN21
          References
          ReferencesLiu, X., et al. 2014. Neuropsychopharm. 29, 989.
          Tao-Chemg, J. H., et al. 2013. Neurosci. 244, 188.
          Ashpole, N.M., et al. 2013. J. Biol. Chem. 288, 14599.
          Vest, R. S., et al. 2007. Mol. Bio. of Cell. 18, 5024.
          Product Information
          FormSolid
          FormulationSupplied as a set of 2 mg TATCN21 (positive control, 5.32441.0001) and 2 mg TATCtrl (negative control, 5.32442.0001). Supplied as a trifluroacetate salt.
          Hygroscopic Hygroscopic
          Applications
          Biological Information
          Primary TargetCaMKII
          Primary Target IC<sub>50</sub>~5 µ
          Purity≥95% by HPLC
          Physicochemical Information
          Peptide SequenceTATCN21: YGRKKRRQRRRKRPPKLGQIGRSKRVVIEDDR
          TATCtrl: YGRKKRRQRRRVKEPRIDGKPVRLRGQKSDRI
          Dimensions
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Shipped at Ambient Temperature or with Blue Ice or with Dry Ice
          Toxicity Standard Handling
          Storage -20°C
          Protect from Light Protect from light
          Hygroscopic Hygroscopic
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up 6 months at -20°C.
          Packaging Information
          Packaged under inert gas Packaged under inert gas
          Transport Information
          Supplemental Information
          Specifications

          Documentation

          References

          Reference overview
          Liu, X., et al. 2014. Neuropsychopharm. 29, 989.
          Tao-Chemg, J. H., et al. 2013. Neurosci. 244, 188.
          Ashpole, N.M., et al. 2013. J. Biol. Chem. 288, 14599.
          Vest, R. S., et al. 2007. Mol. Bio. of Cell. 18, 5024.

          Technical Info

          Title
          White Paper: Further considerations of antibody validation and usage. (EMD)
          Data Sheet

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision28-January-2015 JSW
          Synonymstat-fused CN21
          DescriptionA cell permeable TAT sequence fused with a 21 amino acid peptide derived from the naturally occurring inhibitor protein CaM-KIIN (a.a.43-63; KRPPKLGQIGRSKRVVIEDDR). Acts as a selective, reversible, T-site targeting, inhibitor of CaM Kinase II (~ 5 µM). Effectively blocks CaM kinase II autophophorylation on Thr305/306, however, its effect on Thr286 phosphorylation is not significant. Inhibits both a and b isoforms of CaM kinase II and is shown to block autonomous and stimulated CaM kinase II activities with equal potency. Does not affect the activity of CaM kinase I, protein kinase A, and protein kinase C, however, at 5 µM it has a very mild effect on CaM Kinase IV. Blocks NMDA-induced translocation of CaM kinase II to post-synaptic densities and also inhibits binding of CaM kinase II to NR2B (~1 µM). Shown to reverse long-term potentiation and reduce basal synaptic strength (~ 20 µM). Its inhibitory effects are largely restricted to dendrites, with minimal effect in the soma. The control peptide included in this set contains the TAT sequence fused to a scrambled sequence (VKEPRIDGKPVRLRGQKSDRI).
          FormSolid
          FormulationSupplied as a set of 2 mg TATCN21 (positive control, 5.32441.0001) and 2 mg TATCtrl (negative control, 5.32442.0001). Supplied as a trifluroacetate salt.
          Intert gas (Yes/No) Packaged under inert gas
          Peptide SequenceTATCN21: YGRKKRRQRRRKRPPKLGQIGRSKRVVIEDDR
          TATCtrl: YGRKKRRQRRRVKEPRIDGKPVRLRGQKSDRI
          Purity≥95% by HPLC
          SolubilityH₂O (50 mg/ml)
          Storage -20°C
          Hygroscopic
          Protect from light
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up 6 months at -20°C.
          Toxicity Standard Handling
          ReferencesLiu, X., et al. 2014. Neuropsychopharm. 29, 989.
          Tao-Chemg, J. H., et al. 2013. Neurosci. 244, 188.
          Ashpole, N.M., et al. 2013. J. Biol. Chem. 288, 14599.
          Vest, R. S., et al. 2007. Mol. Bio. of Cell. 18, 5024.