A part of MilliporeSigma

06-596 | Anti-STAT3 Antibody

200 µg  
Retrieving price...
Price could not be retrieved
Minimum Quantity needs to be mulitiple of
Upon Order Completion More Information
You Saved ()
Request Pricing
Limited AvailabilityLimited Availability
Limited Quantities Available
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service

      Special Offers


      Contact Customer Service

      Click To Print This Page


      Replacement Information

      Key Specifications Table

      Species ReactivityKey ApplicationsHostFormatAntibody Type
      H, M, R EMSA, ICC, IP, WB, ChIP Rb Purified Polyclonal Antibody
      Catalogue Number06-596
      Brand Family Upstate
      Trade Name
      • Upstate
      DescriptionAnti-STAT3 Antibody
      Alternate Names
      • Acute-phase response factor
      • DNA-binding protein APRF
      • signal transducer and activator of transcription
      • signal transducer and activator of transcription
      • (acute-phase response factor)
      Background InformationSTAT proteins (Signal Transduction and Activators of Transcription) are latent cytoplasmic transcription factors that have the dual function of signal transduction and activation of transcription. STATs are activated by tyrosine phosphorylation in response to different ligands, after which they translocate to the cell nucleus. The N-terminal region is highly homologous among the STAT proteins and surrounds a completely conserved arginine residue. STATs are a part of the JAK-STAT signaling pathway – a major pathway of the immune system. All cytokines transduce critical signals through this pathway. STAT3 has been shown to be activated by IFN alpha but not IFN beta. The transcription factors associated with STAT3 are cJun and cyclic AMP responsive enhancer binding protein (CREB). Deletion of the STAT3 gene in knock out mice was lethal at the early embryonic stage.
      Product Information
      • EGF-stimulated A431 cells
      PresentationProtein A purified rabbit IgG in 200 L of 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl, 0.05% sodium azide. Frozen at -20°C.
      ApplicationAnti-STAT3 Antibody is a Rabbit Polyclonal Antibody for detection of STAT3 also known as Acute-phase response factor or DNA-binding protein APRF & has been validated in ChIP, EMSA, ICC, IP & WB.
      Key Applications
      • Electrophoretic Mobility Shift Assay
      • Immunocytochemistry
      • Immunoprecipitation
      • Western Blotting
      • Chromatin Immunoprecipitation (ChIP)
      Application NotesImmunoprecipitation:
      4 μg of a previous lot immunoprecipitated STAT3 from 500 μg of EGF-stimulated A431 RIPA lysate.
      Gel Shift Assay:
      An independent laboratory has reported that this antibody supershifts.
      10 μg/mL of a previous lot of this antibody showed positive immunostaining for STAT3 in A431 cells fixed with 95% ethanol, 5% acetic acid.
      Biological Information
      ImmunogenBacterially expressed GST fusion protein corresponding to a.a. 688-722 of human STAT 3 (RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B.
      Epitopea.a. 688-722
      ConcentrationPlease refer to the Certificate of Analysis for the lot-specific concentration.
      SpecificityRecognizes STAT3, Mr 92 kDa. Additional unknown bands may be detected.
      Species Reactivity
      • Human
      • Mouse
      • Rat
      Antibody TypePolyclonal Antibody
      Entrez Gene Number
      Entrez Gene SummaryThe protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
      Gene Symbol
      • APRF
      • FLJ20882
      • HIES
      • MGC16063
      Purification MethodProtein A Purfied
      UniProt Number
      UniProt SummaryFUNCTION: SwissProt: P40763 # Transcription factor that binds to the interleukin-6 (IL-6)-responsive elements identified in the promoters of various acute-phase protein genes. Activated by IL31 through IL31RA.
      SIZE: 770 amino acids; 88068 Da
      SUBUNIT: Forms a homodimer or a heterodimer with a related family member (at least STAT1). Interacts with NCOA1, PELP1, SOCS7 and STATIP1. Interacts with HCV core protein. Interacts with IL23R in presence of IL23. Interacts with IL31RA.
      SUBCELLULAR LOCATION: Cytoplasm. Nucleus. Note=Translocated into the nucleus in response to phosphorylation.
      TISSUE SPECIFICITY: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
      PTM: Tyrosine phosphorylated in response to IL-6, IL-11, CNTF, LIF, CSF-1, EGF, PDGF, IFN-alpha and OSM. Phosphorylated on serine upon DNA damage, probably by ATM or ATR. Serine phosphorylation is important for the formation of stable DNA-binding STAT3 homodimers and maximal transcriptional activity.
      DISEASE: "SwissProt: P40763 # Defects in STAT3 are the cause of hyperimmunoglobulin E recurrent infection syndrome autosomal dominant (AD-HIES) [MIM:147060]; also known as hyper-IgE syndrome or Job syndrome. AD-HIES is a rare disorder of immunity and connective tissue characterized by immunodeficiency, chronic eczema, recurrent Staphylococcal infections, increased serum IgE, eosinophilia, distinctive coarse facial appearance, abnormal dentition, hyperextensibility of the joints, and bone fractures."
      SIMILARITY: SwissProt: P40763 ## Belongs to the transcription factor STAT family. & Contains 1 SH2 domain.
      MISCELLANEOUS: Involved in the gp130-mediated signaling pathway.
      Molecular Weight92 kDa
      Physicochemical Information
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Quality AssuranceRoutinely evaluated by western blot on RIPA lysates from EGF stimulated human A431 cells, mouse WEHI or rat L6.

      Western Blot Analysis:
      0.5-2 μg/mL of this lot detected STAT3 in RIPA lysates from EGF stimulated human A431 cells and previously from mouse WEHI and rat L6.
      Usage Statement
      • Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
      Storage and Shipping Information
      Storage ConditionsStable for 1 year at -20°C from date of receipt.
      Handling Recommendations: Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
      Packaging Information
      Material Size200 µg
      Transport Information
      Supplemental Information




      Safety Data Sheet (SDS) 

      Certificates of Analysis

      TitleLot Number
      Anti-STAT3 - 2453259 2453259
      Anti-STAT3 - 15772 15772
      Anti-STAT3 - 17470 17470
      Anti-STAT3 - 1951972 1951972
      Anti-STAT3 - 2019513 2019513
      Anti-STAT3 - 2040087 2040087
      Anti-STAT3 - 2189947 2189947
      Anti-STAT3 - 22775 22775
      Anti-STAT3 - 2309071 2309071
      Anti-STAT3 - 24010 24010
      Anti-STAT3 - 2533166 2533166
      Anti-STAT3 - 25988 25988
      Anti-STAT3 - 26460 26460
      Anti-STAT3 - 29693 29693
      Anti-STAT3 - 32584 32584
      Anti-STAT3 - 33508 33508
      Anti-STAT3 - DAM1661998 DAM1661998
      Anti-STAT3 - JBC1355757 JBC1355757
      Anti-STAT3 -2578079 2578079
      Anti-STAT3 -2676589 2676589
      Anti-STAT3 -2699197 2699197
      Anti-STAT3 -2709118 2709118
      Anti-STAT3 -2752629 2752629

      References | 38 Available | See All References

      Reference overviewApplicationSpeciesPub Med ID
      Glutamine Deprivation Causes Hydrogen Peroxide-induced Interleukin-8 Expression via Jak1/Stat3 Activation in Gastric Epithelial AGS Cells.
      Lee, YM; Kim, MJ; Kim, Y; Kim, H
      Journal of cancer prevention 20 179-84 2015

      Show Abstract
      26473156 26473156
      Jak1/Stat3 is an upstream signaling of NF-κB activation in Helicobacter pylori-induced IL-8 production in gastric epithelial AGS cells.
      Cha, B; Lim, JW; Kim, H
      Yonsei medical journal 56 862-6 2015

      Show Abstract
      25837197 25837197
      A novel role for histone deacetylase 6 in the regulation of the tolerogenic STAT3/IL-10 pathway in APCs.
      Cheng, F; Lienlaf, M; Wang, HW; Perez-Villarroel, P; Lee, C; Woan, K; Rock-Klotz, J; Sahakian, E; Woods, D; Pinilla-Ibarz, J; Kalin, J; Tao, J; Hancock, W; Kozikowski, A; Seto, E; Villagra, A; Sotomayor, EM
      Journal of immunology (Baltimore, Md. : 1950) 193 2850-62 2014

      Show Abstract
      25108026 25108026
      Radiation-enhanced lung cancer progression in a transgenic mouse model of lung cancer is predictive of outcomes in human lung and breast cancer.
      Delgado, O; Batten, KG; Richardson, JA; Xie, XJ; Gazdar, AF; Kaisani, AA; Girard, L; Behrens, C; Suraokar, M; Fasciani, G; Wright, WE; Story, MD; Wistuba, II; Minna, JD; Shay, JW
      Clinical cancer research : an official journal of the American Association for Cancer Research 20 1610-22 2014

      Show Abstract
      24486591 24486591
      Nucleolar protein trafficking in response to HIV-1 Tat: rewiring the nucleolus.
      Jarboui, MA; Bidoia, C; Woods, E; Roe, B; Wynne, K; Elia, G; Hall, WW; Gautier, VW
      PloS one 7 e48702 2012

      Show Abstract
      Western Blotting23166591 23166591
      Preclinical characterization of atiprimod, a novel JAK2 AND JAK3 inhibitor.
      Alfonso Quintás-Cardama,Taghi Manshouri,Zeev Estrov,David Harris,Ying Zhang,Amos Gaikwad,Hagop M Kantarjian,Srdan Verstovsek
      Investigational new drugs 29 2011

      Show Abstract
      20372971 20372971
      NFĸB is an unexpected major mediator of interleukin-15 signaling in cerebral endothelia.
      Stone, KP; Kastin, AJ; Pan, W
      Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology 28 115-24 2011

      Show Abstract
      21865854 21865854
      Histone deacetylase inhibitor LAQ824 augments inflammatory responses in macrophages through transcriptional regulation of IL-10.
      Wang, H; Cheng, F; Woan, K; Sahakian, E; Merino, O; Rock-Klotz, J; Vicente-Suarez, I; Pinilla-Ibarz, J; Wright, KL; Seto, E; Bhalla, K; Villagra, A; Sotomayor, EM
      Journal of immunology (Baltimore, Md. : 1950) 186 3986-96 2011

      Show Abstract
      Western Blotting21368229 21368229
      Bone marrow stroma-secreted cytokines protect JAK2(V617F)-mutated cells from the effects of a JAK2 inhibitor.
      Manshouri, T; Estrov, Z; Quintás-Cardama, A; Burger, J; Zhang, Y; Livun, A; Knez, L; Harris, D; Creighton, CJ; Kantarjian, HM; Verstovsek, S
      Cancer research 71 3831-40 2011

      Show Abstract
      21512135 21512135
      Different changes in protein and phosphoprotein levels result from serum starvation of high-grade glioma and adenocarcinoma cell lines.
      Levin, VA; Panchabhai, SC; Shen, L; Kornblau, SM; Qiu, Y; Baggerly, KA
      Journal of proteome research 9 179-91 2010

      Show Abstract
      Western BlottingHuman19894763 19894763

      Related Products & Applications

      Related Products

      Catalog Number Description  
      04-1014 Anti-STAT3 Antibody, clone E121-21, rabbit monoclonal Show Pricing & Availability
      04-1059 Anti-phospho-STAT3 (Tyr705) Antibody, clone EP2147Y, rabbit monoclonal Show Pricing & Availability
      05-1078 Anti-STAT3 Antibody, clone 18F7.1 Show Pricing & Availability
      05-485 Anti-phospho-STAT3 (Tyr705) Antibody, clone 9E12 Show Pricing & Availability
      07-1347 Anti-phospho-STAT3 (Tyr68) Antibody Show Pricing & Availability
      07-2173 Anti-Stat3 Antibody Show Pricing & Availability
      07-703 Anti-phospho-STAT3 (Ser727) Antibody Show Pricing & Availability
      ABE1397 Anti-trimethyl STAT3 (Lys180) Antibody Show Pricing & Availability
      MAB3705 Anti-STAT3 Antibody, phospho (Ser727), clone 6E4 Show Pricing & Availability

      Included Positive Control

      Catalog Number Description  
      12-302 EGF-Stimulated A431 Cell Lysate Show Pricing & Availability

      View Gene Related Products for this Target


      Life Science Research > Antibodies and Assays > Primary Antibodies