208711 | Ca2+/Calmodulin Kinase II Inhibitor 281-309 - Calbiochem

208711
Price could not be retrieved
Minimum Quantity needs to be mulitiple of
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Limited AvailabilityLimited Availability
Stocked 
Discontinued
Limited Quantities Available
Available
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      View Pricing & Availability
      Click To Print This Page

      Overview

      Replacement Information

      Key Specifications Table

      Empirical Formula
      C₁₄₆H₂₅₄N₄₆O₃₉S₃

      Pricing & Availability

      Catalog NumberAvailability Packaging Qty/Pack Price Quantity
      208711-500UG
      Retrieving availability...
      Limited AvailabilityLimited Availability
      Stocked 
      Discontinued
      Limited Quantities Available
      Available
        Remaining : Will advise
          Remaining : Will advise
          Will advise
          Contact Customer Service

          Plastic ampoule 500 μg
          Retrieving price...
          Price could not be retrieved
          Minimum Quantity needs to be mulitiple of
          Upon Order Completion More Information
          You Saved ()
           
          Request Pricing
          Description
          OverviewA synthetic peptide that contains the CaM-binding, inhibitory, and autophosphorylation domains of CaM kinase II. Can be phosphorylated at Thr286 by PKC. Useful as a calmodulin binding peptide. Inhibits CaM kinase II (IC50 = 80 nM) by blocking Ca2+/calmodulin activation and enzyme active site (IC50 = 2 µM).
          Catalogue Number208711
          Brand Family Calbiochem®
          SynonymsCaM Kinase II Inhibitor 281-309, MHRQETVDCLKKFNARRKLKGAILTTMLA-OH
          References
          ReferencesWaxham, M.N., et al. 1993. Biochemistry 32, 2923.
          Waxham, M.N., et al. 1993. Brain Res. 609, 1.
          Fukunaga, K., et al. 1990. J. Neurochem. 54, 103.
          Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800.
          Colbran, R.J., et al. 1988. J. Biol. Chem. 263, 18145.
          Product Information
          ATP CompetitiveN
          FormLyophilized solid
          FormulationSupplied as a trifluoroacetate salt.
          Hill FormulaC₁₄₆H₂₅₄N₄₆O₃₉S₃
          Chemical formulaC₁₄₆H₂₅₄N₄₆O₃₉S₃
          Hygroscopic Hygroscopic
          ReversibleN
          Sold on the basis of peptide contentY
          Applications
          Biological Information
          Primary TargetCaM Kinase II
          Primary Target IC<sub>50</sub>80nM
          Purity≥97% by HPLC
          Physicochemical Information
          Cell permeableN
          Peptide ContentY
          Peptide SequenceH-Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH
          Dimensions
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Standard Handling
          Storage -20°C
          Hygroscopic Hygroscopic
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Packaging Information
          Transport Information
          Supplemental Information
          Specifications

          Documentation

          SDS

          Title

          Safety Data Sheet (SDS) 

          Certificates of Analysis

          TitleLot Number
          208711

          References

          Reference overview
          Waxham, M.N., et al. 1993. Biochemistry 32, 2923.
          Waxham, M.N., et al. 1993. Brain Res. 609, 1.
          Fukunaga, K., et al. 1990. J. Neurochem. 54, 103.
          Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800.
          Colbran, R.J., et al. 1988. J. Biol. Chem. 263, 18145.

          Brochure

          Title
          Calmodulin and Related Products Technical Bulletin

          Citations

          Title
        • Liangwen Xiong, et al. (2005) A Ca2+ Binding Domain in RyR1 That Interacts with the Calmodulin Binding Site and Modulates Channel Activity. Biophysical Journal in press,.
        • Data Sheet

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision05-June-2008 RFH
          SynonymsCaM Kinase II Inhibitor 281-309, MHRQETVDCLKKFNARRKLKGAILTTMLA-OH
          DescriptionA synthetic peptide containing the calmodulin binding site (290-309) and the autophosphorylation site (Thr286) of CaM kinase II. Can be phosphorylated at Thr286 by PKC. Useful as a calmodulin binding peptide. Inhibits CaM kinase II by blocking Ca2+/calmodulin activation (IC50 = 80 nM) and enzyme-active site (IC50 = 2 µM).
          FormLyophilized solid
          FormulationSupplied as a trifluoroacetate salt.
          Chemical formulaC₁₄₆H₂₅₄N₄₆O₃₉S₃
          Peptide SequenceH-Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH
          Purity≥97% by HPLC
          SolubilityH₂O (5 mg/ml)
          Storage -20°C
          Hygroscopic
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Toxicity Standard Handling
          ReferencesWaxham, M.N., et al. 1993. Biochemistry 32, 2923.
          Waxham, M.N., et al. 1993. Brain Res. 609, 1.
          Fukunaga, K., et al. 1990. J. Neurochem. 54, 103.
          Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800.
          Colbran, R.J., et al. 1988. J. Biol. Chem. 263, 18145.
          Citation
        • Liangwen Xiong, et al. (2005) A Ca2+ Binding Domain in RyR1 That Interacts with the Calmodulin Binding Site and Modulates Channel Activity. Biophysical Journal in press,.