374087 | Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1)

Price could not be retrieved
Minimum Quantity needs to be mulitiple of
Upon Order Completion More Information
You Saved ()
Request Pricing
Limited AvailabilityLimited Availability
Limited Quantities Available
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      View Pricing & Availability
      Click To Print This Page


      Replacement Information

      Key Specifications Table

      Species ReactivityHostAntibody Type
      B, Ca, H, Mk, M, R M Monoclonal Antibody

      Pricing & Availability

      Catalog NumberAvailability Packaging Qty/Pack Price Quantity
      Retrieving availability...
      Limited AvailabilityLimited Availability
      Limited Quantities Available
        Remaining : Will advise
          Remaining : Will advise
          Will advise
          Contact Customer Service

          Plastic ampoule 200 μg
          Retrieving price...
          Price could not be retrieved
          Minimum Quantity needs to be mulitiple of
          Upon Order Completion More Information
          You Saved ()
          Request Pricing
          OverviewRecognizes the ~32 kDa HO-1 protein.
          Catalogue Number374087
          Brand Family Calbiochem®
          SynonymsAnti-HO-1, Anti-Hsp32
          Application Data
          Detection of human heme oxygenase-1 by immunoblotting. Sample: Extract from human microsomes. Primary antibody: Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (Cat. No. 374087) (1:250). Detection: chemiluminescence.

          Detection of human heme oxygenase-1 by flow cytometry. Sample: Human lung cancer A2 cells (both panels). Primary antibodies: Isotope control (left panel) and Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (right panel) (Cat. No. 374087) (10 µg/ml). Detection: fluorescence.
          ReferencesYoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
          Maines, M.D. 1988. FASEB J. 2, 2557.
          Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.
          Product Information
          FormulationIn PBS, 50% glycerol.
          Preservative≤0.1% sodium azide
          Key Applications Immunoblotting (Western Blotting)
          Application NotesImmunoblotting (4 µg/ml, chemiluminescence)
          Immunocytochemistry (1:1000)
          Immunoprecipitation (20 µg/ml)
          Application CommentsDoes not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
          Biological Information
          Immunogena synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
          Species Reactivity
          • Bovine
          • Canine
          • Human
          • Monkey
          • Mouse
          • Rat
          Antibody TypeMonoclonal Antibody
          Concentration Label Please refer to vial label for lot-specific concentration
          Physicochemical Information
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Blue Ice Only
          Toxicity Standard Handling
          Storage -20°C
          Avoid freeze/thaw Avoid freeze/thaw
          Do not freeze Ok to freeze
          Special InstructionsFollowing initial thaw, aliquot and freeze (-20°C).
          Packaging Information
          Transport Information
          Supplemental Information




          Safety Data Sheet (SDS) 

          Certificates of Analysis

          TitleLot Number


          Reference overview
          Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
          Maines, M.D. 1988. FASEB J. 2, 2557.
          Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.


          Antibody Sourcebook!" Second Edition
          Nitric Oxide and Oxidative Stress Brochure
          Data Sheet

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision11-November-2011 JSW
          SynonymsAnti-HO-1, Anti-Hsp32
          ApplicationImmunoblotting (4 µg/ml, chemiluminescence)
          Immunocytochemistry (1:1000)
          Immunoprecipitation (20 µg/ml)
          Application Data
          Detection of human heme oxygenase-1 by immunoblotting. Sample: Extract from human microsomes. Primary antibody: Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (Cat. No. 374087) (1:250). Detection: chemiluminescence.

          Detection of human heme oxygenase-1 by flow cytometry. Sample: Human lung cancer A2 cells (both panels). Primary antibodies: Isotope control (left panel) and Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (right panel) (Cat. No. 374087) (10 µg/ml). Detection: fluorescence.
          DescriptionProtein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.
          BackgroundHeme oxygenase (HO) is a microsomal enzyme that oxidatively cleaves heme, a pro-oxidant, into carbon monoxide and biliverdin, which is reduced to the antioxidant, bilirubin. Two isozymes, termed HO-1 and HO-2, have been identified in rat, rabbit, monkey, and human tissues. By SDS-PAGE, mammalian HO-1 is ~31-33 kDa; HO-2 is ~36 kDa. HO-1, also referred to as stress protein Hsp32, is the inducible form of the enzyme. Expression of HO-1 can be induced by a variety of stimuli such as heme, metals, hormones, UV radiation and sulfhydryl depleting agents. In contrast, HO-2 is the constitutive form of the enzyme. HO-2 is the most prevalent form in most tissues, except the spleen where HO-1 levels are predominant.
          Immunogen speciesHuman
          Immunogena synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
          Speciesbovine, canine, human, monkey, mouse, rat
          FormulationIn PBS, 50% glycerol.
          Concentration Label Please refer to vial label for lot-specific concentration
          Preservative≤0.1% sodium azide
          CommentsDoes not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
          Storage -20°C
          Avoid freeze/thaw
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing initial thaw, aliquot and freeze (-20°C).
          Toxicity Standard Handling
          ReferencesYoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
          Maines, M.D. 1988. FASEB J. 2, 2557.
          Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.