374090 | Anti-Heme Oxygenase-1 (1-30) Rabbit pAb

374090
Price could not be retrieved
Minimum Quantity needs to be mulitiple of
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Limited AvailabilityLimited Availability
Stocked 
Discontinued
Limited Quantities Available
Available
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      View Pricing & Availability
      Click To Print This Page

      Overview

      Replacement Information

      Key Specifications Table

      Species ReactivityHostAntibody Type
      Ca, Ht, H, Mk, M, R Rb Polyclonal Antibody

      Pricing & Availability

      Catalog NumberAvailability Packaging Qty/Pack Price Quantity
      374090-100UL
      Retrieving availability...
      Limited AvailabilityLimited Availability
      Stocked 
      Discontinued
      Limited Quantities Available
      Available
        Remaining : Will advise
          Remaining : Will advise
          Will advise
          Contact Customer Service

          Plastic ampoule 100 ul
          Retrieving price...
          Price could not be retrieved
          Minimum Quantity needs to be mulitiple of
          Upon Order Completion More Information
          You Saved ()
           
          Request Pricing
          Description
          OverviewRecognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2.
          Catalogue Number374090
          Brand Family Calbiochem®
          SynonymsAnti-HO-1, Anti-Hsp32
          Application Data
          Detection of heme oxygenase-1 by immunoblotting. Samples: Recombinant rat HO-1 (lane 1), recombinant human HO-1 (lane 2), negative control recombinant human protein (lane 3), extracts from dog liver microsomes (lane 4), mouse liver microsomes (lane 5), rat liver microsomes (lane 6), and human liver microsomes (lane 7). Primary antibody: Anti-Heme Oxygenase-1 (1-30) Rabbit pAb (Cat. No. 374090) (1:1000). Detection: chemiluminescence.
          References
          ReferencesMaines, M.D. 1988 FASEB J. 2, 2557.
          Kutty, R.K., et al. 1994. J. Cell Physiol. 159, 371.
          Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
          Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.
          Product Information
          FormLiquid
          FormulationIn PBS, 50% glycerol, pH 7.2.
          Preservative≤0.1% sodium azide
          Applications
          Key Applications Immunoblotting (Western Blotting)
          Immunoprecipitation
          Application NotesImmunoblotting (1:1000, chemiluminescence)
          Immunoprecipitation (1:100)
          Application CommentsDoes not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
          Biological Information
          Immunogena synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
          ImmunogenHuman
          HostRabbit
          IsotypeIgG
          Species Reactivity
          • Canine
          • Hamster
          • Human
          • Monkey
          • Mouse
          • Rat
          Antibody TypePolyclonal Antibody
          Physicochemical Information
          Dimensions
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          S PhraseS: 24/25-36-A09

          Avoid contact with skin and eyes.
          Wear suitable protective clothing.
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Standard Handling
          Storage -20°C
          Avoid freeze/thaw Avoid freeze/thaw
          Do not freeze Ok to freeze
          Special InstructionsFollowing initial thaw, aliquot and freeze (-20°C).
          Packaging Information
          Transport Information
          Supplemental Information
          Specifications

          Documentation

          SDS

          Title

          Safety Data Sheet (SDS) 

          Certificates of Analysis

          TitleLot Number
          374090

          References

          Reference overview
          Maines, M.D. 1988 FASEB J. 2, 2557.
          Kutty, R.K., et al. 1994. J. Cell Physiol. 159, 371.
          Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
          Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.

          Brochure

          Title
          Antibody Sourcebook!" Second Edition
          Nitric Oxide and Oxidative Stress Brochure
          Data Sheet

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision15-December-2008 JSW
          SynonymsAnti-HO-1, Anti-Hsp32
          ApplicationImmunoblotting (1:1000, chemiluminescence)
          Immunoprecipitation (1:100)
          Application Data
          Detection of heme oxygenase-1 by immunoblotting. Samples: Recombinant rat HO-1 (lane 1), recombinant human HO-1 (lane 2), negative control recombinant human protein (lane 3), extracts from dog liver microsomes (lane 4), mouse liver microsomes (lane 5), rat liver microsomes (lane 6), and human liver microsomes (lane 7). Primary antibody: Anti-Heme Oxygenase-1 (1-30) Rabbit pAb (Cat. No. 374090) (1:1000). Detection: chemiluminescence.
          DescriptionProtein A purified rabbit polyclonal antibody. Recognizes the ~32 kDa HO-1 protein.
          BackgroundHeme oxygenase (HO) is a microsomal enzyme that oxidatively cleaves heme, a pro-oxidant, into carbon monoxide and biliverdin, which is reduced to the antioxidant, bilirubin. Two isozymes, termed HO-1 and HO-2, have been identified. By SDS-PAGE, mammalian HO-1 is ~31-33 kDa; HO-2 is ~36 kDa. HO-1, also referred to as stress protein Hsp32, is the inducible form of the enzyme. HO-1 expression can be induced by a variety of stimuli such as heme, metals, hormones, UV radiation and sulfhydryl depleting agents. In contrast, HO-2 is constitutively expressed. HO-2 is the most prevalent form in most tissues, except the spleen where HO-1 levels are predominant.
          HostRabbit
          Immunogen speciesHuman
          Immunogena synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
          IsotypeIgG
          Speciescanine, hamster, human, monkey, mouse, rat
          FormLiquid
          FormulationIn PBS, 50% glycerol, pH 7.2.
          Preservative≤0.1% sodium azide
          CommentsDoes not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
          Storage -20°C
          Avoid freeze/thaw
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing initial thaw, aliquot and freeze (-20°C).
          Toxicity Standard Handling
          ReferencesMaines, M.D. 1988 FASEB J. 2, 2557.
          Kutty, R.K., et al. 1994. J. Cell Physiol. 159, 371.
          Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
          Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.